PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400047411
Common NameLOC102587928
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family GATA
Protein Properties Length: 170aa    MW: 18833.6 Da    PI: 10.0923
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400047411genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.95.6e-186194134
                  GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34
                          C +C  tkTp+WR gp g+ktLCnaCG++y+k +
  PGSC0003DMP400047411 61 CLHCEITKTPQWRAGPMGPKTLCNACGVRYKKGR 94
                          99******************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004013.8E-1755105IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.495591IPR000679Zinc finger, GATA-type
SuperFamilySSF577166.65E-1659118No hitNo description
Gene3DG3DSA:3.30.50.102.8E-155994IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.52E-1460107No hitNo description
PfamPF003208.6E-166195IPR000679Zinc finger, GATA-type
PROSITE patternPS0034406186IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    Send to blast
MFPTSVIPQQ FVAPGVNSLE SENFAESPMK KKKKIKLSIP LAPIETNQDN YQPAPQAVRK  60
CLHCEITKTP QWRAGPMGPK TLCNACGVRY KKGRLYPEYR PAASPTFVPS LHSNSHKKVL  120
EMRSNVFPEE DTDYKQAKPR QARPLIIGQA ENNTTASTTP TAQSDLNPK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754430.0HG975443.1 Solanum pennellii chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006350223.11e-122PREDICTED: GATA transcription factor 8-like
RefseqXP_006350222.11e-122PREDICTED: GATA transcription factor 8-like
SwissprotQ9SV301e-41GATA8_ARATH; GATA transcription factor 8
TrEMBLM1CLQ81e-124M1CLQ8_SOLTU; Uncharacterized protein
TrEMBLM1CLQ91e-122M1CLQ9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000701341e-121(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54810.22e-42GATA family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]